PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G1166
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 296aa    MW: 32898.4 Da    PI: 7.9732
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G1166genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.6e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEde+l +++k++G g W++ ++  g+ R++k+c++rw +yl
      Gh_A08G1166 14 KGPWAPEEDEILTNYIKKHGHGGWRSLPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding48.12.7e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE++l +++++ lG++ W++Ia+ ++ +Rt++++k+ w+++l
      Gh_A08G1166  67 RGPFTLEEEKLVIQLHAILGNR-WAAIAAQFP-RRTDNEIKNLWNTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.5E-25564IPR009057Homeodomain-like
PROSITE profilePS5129415.666961IPR017930Myb domain
SuperFamilySSF466892.51E-2911108IPR009057Homeodomain-like
SMARTSM007174.7E-121363IPR001005SANT/Myb domain
PfamPF002496.1E-141461IPR001005SANT/Myb domain
CDDcd001671.06E-91661No hitNo description
PROSITE profilePS5129424.50662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-2565116IPR009057Homeodomain-like
SMARTSM007174.1E-1466114IPR001005SANT/Myb domain
PfamPF002492.3E-1467112IPR001005SANT/Myb domain
CDDcd001671.34E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGRAPCCDKK GLKKGPWAPE EDEILTNYIK KHGHGGWRSL PKLAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF TLEEEKLVIQ LHAILGNRWA AIAAQFPRRT DNEIKNLWNT HLKKRLLCLG  120
LDPQTHKPFT PCGGPTVAAP TSPATRHMAQ WESARLEAEA RLSKESLQTN SPPIAKPDSD  180
HFLRLWNSEV GESFRKINTE YKTVYPCPSP ISQTSSSAKC GSVSAVTMDV CPNIAGSLNP  240
ASNPIEETEC KSFVKSCIEE RSDSSCSSES EDSSDTALQL LLDFPINNDM SFLENC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.38040.0ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591812e-68AJ459181.1 Gossypium hirsutum partial myb151 gene, clone pGhMYB151.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475173.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A0B0N3Y20.0A0A0B0N3Y2_G
STRINGPOPTR_0014s07700.11e-144(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69822643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-119myb domain protein 17